PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02517.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 337aa    MW: 38674 Da    PI: 6.3591
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02517.1_g00007.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.32.9e-53111391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eel+++yLkkkv+++k++l +vi+evd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+W
  Sme2.5_02517.1_g00007.1  11 VPPGFRFHPTEEELLQYYLKKKVANEKIDL-DVIQEVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFW 95 
                              69****************************.9***************964444222455*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk ++s +++ +g++ktLvfykgrap+g+k+dW+mheyrl
  Sme2.5_02517.1_g00007.1  96 KATGRDKVIHS-NSQRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                              *********99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.76E-587174IPR003441NAC domain
PROSITE profilePS5100556.7411174IPR003441NAC domain
PfamPF023651.8E-2812139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MSISVNGQSQ VPPGFRFHPT EEELLQYYLK KKVANEKIDL DVIQEVDLNK LEPWDIQEKC  60
KIGSTPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKVIHSNSQR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DHINDMHSCT IVCNIVMGES TQEEGWVICR IFKKKNHVKS  180
LETISSASSQ LISDTGISER LYPNDEGPLE QLLHYMRSST CKEENHVMNN YDTNFHDKFM  240
QLPSLDSPNS SSGDHKSTIN CEGGLNNWIA VDRLVASHLN GQTINDYNHD YEHQYNTNIV  300
EGGSTNHDYQ EDQCDLWSFS RVSSTNDSLC HVSNGMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-5151769170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016544607.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-123NAC43_ARATH; NAC domain-containing protein 43
TrEMBLV9LXI70.0V9LXI7_TOBAC; NAC secondary wall thickening promoting factor 3
STRINGPGSC0003DMT4000293210.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-113NAC family protein